Plum Fintech

Plum Fintech

Company

Legal NamePlum Limited
HeadquartersLondon, United Kingdom
Websitehttps://withplum.com

About Plum Fintech

Plum is powered by automation, and acts like an autopilot for your money. You sit at the controls, with smart spending analytics and budgeting tools to help you set your financial destination. Plum gets you there safely, so you don’t need to remember things like setting money aside, getting the best deal on household bills. Plum’s making your savings and investments work for you.. Our Mission: We’ve Imagined a world where people effortlessly manage their money without having to worry, or even think about it. A world where our users’ money has a brain that’s configured to automatically reach what is important to them. ...And here at Plum, we made it our mission to build that world... and we’re now ready to make it a reality for Plumsters. We welcome them to our reality! Where their money works for them, and their entire financial journey is easier by an autopilot, controlled by them. What We Offer: A bucketful of challenging problems to solve, so hopefully that's your thing! Our job is to take a complicated, archaic domain and make it simple and accessible to everyone. One of the best learning experiences of your life. You'll get to work with extremely smart and capable people, with backgrounds in finance, physics, history, computing, languages and more. Competitive pay and company stock options – we are all in this together! 25 days holiday a year, excluding bank holidays (33 in total). Work from our London or Athens office (almost) whenever you want 🇬🇧🇬🇷 Team trip to secret destinations once a year ✈️ Free Plum Pro subscription Breakfast, fresh fruit (plums obviously), snacks with varying health benefits and great coffee. Plants, lots of plants 🌱

Synonyms

plumplum fintechplum fintech limited

Technologies (from Job Ads)

roxio toastiterationapp storeautoconfbigquerygrafanaopenstackpythonawscross-platform softwareioios sdkjirapostgresqlrabbitmqsoftware engineeringterraformtype systemworkspacegmailsqlsystemdcheckstyledeep learninggoogle meetmacintoshmicrosoft excelmicrosoft officescalabilityturned a

Hiring Locations

CountryCityJob Ads
United KingdomLondon401
GreeceAthens46
CyprusΛευκωσία - Lefkoşa33
CyprusNicosia26

Headquarters

Loading map...

Company Info

Legal Form: Limited

Company Type: Private

Company Size: 51 - 250

Job Ad Metrics

Job Ads found: 506

Job Ads per Month: 10.8

Hiring Locations: 4

Data Info

Date of first job ad20.12.2019, 06:54
Date of last job ad23.12.2025, 12:59
Date merged25.12.2025, 01:18
Date created20.12.2019, 06:54

Sources: Britishjobs, Careerbuilder, Careerjet, Efinancialcareers, Glassdoor, Indeed, Jora, Linkedin, Monster, Simplyhired, Workable
 — Date merged: 25.12.2025, 01:18